S2539_MOUSE Q9D8K8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D8K8
Recommended name:Solute carrier family 25 member 39
EC number:
Alternative names:
Cleaved into:
GeneID:68066
Gene names (primary ):Slc25a39
Gene names (synonym ):D11Ertd333e
Gene names (ORF ):
Length:359
Mass:39221
Sequence:MDDQDPGGISPLQQMVASGAGAVVTSLFMTPLDVVKVRLQSQRPSATSELTTPSRFWSLSYTKSSSALQSPGKCLLYCNGVLEPLYLCPNGTRCATWFQDPTRFTGTLDAFVKIVRHEGTRTLWSGLPATLVMTVPATAIYFTAYDQLKAFLCGQSLTSDLYAPMVAGALARMGTVTVVSPLELVRTKLQAQHVSYRELASSVQAAVTQGGWRSLWLGWGPTALRDVPFSALYWFNYELVKSWLSGLRPKDQTSVGISFVAGGISGMVAATLTLPFDVVKTQRQMSLGAVEAVRVKPPRVDSTWLLLRRIRAESGTRGLFAGFLPRIIKAAPSCAIMISTYEFGKSFFQRLNQEQPLGR
Tissue specificity:Abundant expression in bone marrow, spleen, testis and kidney. {ECO:0000269|PubMed:19656490}.
Induction:
Developmental stage:Highly express in primitive erythroblast that fill yorlk sac blood islands at early somite pair stages, and in fetal liver at 12.5 dpc. {ECO:0000269|PubMed:19656490}.
Protein families:Mitochondrial carrier (TC 2.A.29) family