TSCOT_MOUSE Q8CA03
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8CA03
Recommended name：Thymic stromal cotransporter protein
EC number：
Alternative names：(Solute carrier family 46 member 2)
Cleaved into：
GeneID：30936
Gene names (primary )：Slc46a2
Gene names (synonym )：Tscot
Gene names (ORF )：
Length：479
Mass：52083
Sequence：MGPGGTCPWSSRLSGFRVRTWIEPVVASTQVAGSLYDAGLLLVVKESFKSEAGGSSNYSANQSLVEYQEDQQQKAISNFNIIYNLVLGLTPLLSAYGLGWLSDRYHRKISICTAMLGFLLSRIGLLLKVMLDWPVEVMYGAAALNGLCGSFSAYWSGVMALGSLGCSEGRRSVRLILIDLVLGLAGFSGSMASGHLFKQIVGHSAQGLLLTACSVGCAAFALFYSLFVLKVPESKPNKVHPTVDTVSGMMGTYRTLDPDQQDKQNVPRNPRTPGKGKSSQREVVALLFVGAIIYDLAAVGTVDVMALFVLKEPLHWNQVQLGYGMASGYIIFITSFLGVLVFSRCFRDTTMIIIGMLSFGSGALLLAFVKETYMFYIARAIMLFALIPITTIRSAMSKLIKDSSYGKIFVILQLCLTLTGVVTSTIYNKIYQLTLDKFIGTCFVLSSFLSFLAIVPIGVVAYKQVPRSQQGECAEKQRS
Tissue specificity：Expressed on cortical epithelial cells in the thymus. Mainly expressed in the thymic cortex and is highly enriched in SCID thymus. Also expressed in lymph nodes, heart, fetal liver, brain, spleen, intestine and kidney, but not in adult liver, skin, skeletal muscle and lung. {ECO:0000269|PubMed:10706709, ECO:0000269|PubMed:10978518}.
Induction：
Developmental stage：Highly expressed during fetal thymus development and decreases after day 16. {ECO:0000269|PubMed:10706709}.
Protein families：Major facilitator superfamily, SLC46A family