TM119_MOUSE Q8R138
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8R138
Recommended name：Transmembrane protein 119
EC number：
Alternative names：(Osteoblast induction factor) (OBIF)
Cleaved into：
GeneID：231633
Gene names (primary )：Tmem119
Gene names (synonym )：
Gene names (ORF )：
Length：280
Mass：29401
Sequence：MVPWFLLSLLLLARPVPGVAYSVSLPASFLEDVAGSGEAEGSSASSPSLPPPGTPAFSPTPERPQPTALDGPVPPTNLLEGIMDFFRQYVMLIAVVGSLTFLIMFIVCAALITRQKHKATAYYPSSFPEKKYVDQRDRAGGPRTFSEVPDRAPDSRHEEGLDTSHQLQADILAATQNLRSPARALPGNGEGAKPVKGGSEEEEEEVLSGQEEAQEAPVCGVTEEKLGVPEESVSAEAEGVPATSEGQGEAEGSFSLAQESQGATGPPESPCACNRVSPSV
Tissue specificity：Expressed in spermatocytes and spermatids in the developing testis (at protein level). Expressed in the brain, heart, lung, spleen, skeletal muscle, ovary, testis and epididymis (PubMed:26207632). Predominantly expressed in osteoblasts (PubMed:20025746). {ECO:0000269|PubMed:20025746, ECO:0000269|PubMed:26207632}.
Induction：By parathyroid hormone (PTH) in osteoblasts (at protein level). {ECO:0000269|PubMed:21239498}.
Developmental stage：Highly expressed in early and late stage osteoblasts of developing embryos (at protein level). {ECO:0000269|PubMed:20025746}.
Protein families：