CCDB1_MOUSE Q3TVC7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q3TVC7
Recommended name：Cyclin-D1-binding protein 1
EC number：
Alternative names：(Grap2 and cyclin-D-interacting protein) (Maternal Id-like protein) (Stage specific embryonic cDNA-8 protein) (SSEC-8)
Cleaved into：
GeneID：17151
Gene names (primary )：Ccndbp1
Gene names (synonym )：Dip1 Gcip Maid
Gene names (ORF )：
Length：356
Mass：39356
Sequence：MASSTAAVPFLAPPLEQLRHLAEELRSLLPRVRVGEAQETAEEFNREMFWRRLNEAAVKVNGEATVLTTHFSKLPWPSPQETQRICEQVRIAIEEIIIVYYSLPKDQGITLRKLVRNAALDIVDGMAQLLEVLLTAPSQSTENGDLISCNSVSVACQQVPEIPKDNKAAALLMLTKSVDFVKDAHEEMEQAVEECDPYSGLLNDSEDNSDSHSDEDGVLGLPSNRDSYWSEEDQELIIPCLALVRASRASLKKIRILVAENGKKDEVAQLDDIVDISDEISPSVDDLVLSIYPPVCHLTVRISSAKLVSVLIKALEITKASHVSPHPGDSWIPLLINAVDHCMNRIKALTQRAAEL
Tissue specificity：Expressed at high levels in brain, intestine, muscle and ovary and at lower levels in heart, kidney, liver, lung, spleen and testis. {ECO:0000269|PubMed:9186056}.
Induction：Expression is induced by partial hepatectomy. {ECO:0000269|PubMed:17256742}.
Developmental stage：Highly expressed in the unfertilized egg. Expression is reduced at the two cell and blastocyst stages. Expressed in the liver, CNS and dorsal root ganglia throughout organogenesis. Also expressed in the intestine, kidney, lung, nasal cavities and thymus from 13 dpc. {ECO:0000269|PubMed:17256742, ECO:0000269|PubMed:9186056}.
Protein families：CCNDBP1 family