DEST_MOUSE   Q9R0P5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9R0P5

Recommended name:Destrin

EC number:

Alternative names:(Actin-depolymerizing factor) (ADF) (Sid 23)

Cleaved into:

GeneID:56431

Gene names  (primary ):Dstn

Gene names  (synonym ):Dsn Sid23

Gene names  (ORF ):

Length:165

Mass:18522

Sequence:MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIVVEEGKEILVGDVGATITDPFKHFVGMLPEKDCRYALYDASFETKESRKEELMFFLWAPEQAPLKSKMIYASSKDAIKKKFPGIKHEYQANGPEDLNRTCIAEKLGGSLIVAFEGSPV

Tissue specificity:Widely expressed. Not found in skeletal muscle. {ECO:0000269|PubMed:11809832}.

Induction:

Developmental stage:In 10.5 dpc embryo somites is expressed in a superficial patch of cells (adaxial region). {ECO:0000269|PubMed:11809832}.

Protein families:Actin-binding proteins ADF family


   💬 WhatsApp