RORG_MOUSE P51450
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P51450
Recommended name：Nuclear receptor ROR-gamma
EC number：
Alternative names：(Nuclear receptor RZR-gamma) (Nuclear receptor subfamily 1 group F member 3) (RAR-related orphan receptor C) (Retinoid-related orphan receptor-gamma) (Thymus orphan receptor) (TOR)
Cleaved into：
GeneID：19885
Gene names (primary )：Rorc
Gene names (synonym )：Nr1f3 Rorg Thor
Gene names (ORF )：
Length：516
Mass：58117
Sequence：MDRAPQRHHRTSRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQCNVAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQQQQQEQVAKTPPAGSRGADTLTYTLGLSDGQLPLGASPDLPEASACPPGLLRASGSGPPYSNTLAKTEVQGASCHLEYSPERGKAEGRDSIYSTDGQLTLGRCGLRFEETRHPELGEPEQGPDSHCIPSFCSAPEVPYASLTDIEYLVQNVCKSFRETCQLRLEDLLRQRTNLFSREEVTSYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIILLTAGAMEVVLVRMCRAYNANNHTVFFEGKYGGVELFRALGCSELISSIFDFSHFLSALCFSEDEIALYTALVLINANRPGLQEKRRVEHLQYNLELAFHHHLCKTHRQGLLAKLPPKGKLRSLCSQHVEKLQIFQHLHPIVVQAAFPPLYKELFSTDVESPEGLSK
Tissue specificity：Expressed in immature Vgamma2 gamma-delta T-cells (at protein level) (PubMed:23562159). Expressed in the liver (PubMed:17666523, PubMed:22753030). Expressed in the heart (PubMed:17666523). Expressed in the kidney, jejunum, and brown adipose tissue (PubMed:22753030). {ECO:0000269|PubMed:17666523, ECO:0000269|PubMed:22753030, ECO:0000269|PubMed:23562159}.; [Isoform 1]: Expressed in muscle and the thymus (PubMed:9881970, PubMed:10602018). Expressed in the brain, heart, kidney, liver, and lung (PubMed:9881970). Expressed in testes (PubMed:10602018). Not expressed in the spleen or bone marrow (PubMed:9881970). {ECO:0000269|PubMed:10602018, ECO:0000269|PubMed:9881970}.; [Isoform 2]: Expressed in the thymus, primarily in immature thymocytes, including Vgamma2 gamma-delta T-cells (at protein levels) (PubMed:9881970, PubMed:10602018). Also expressed in a subset of mature T(H)17 cells (PubMed:18164222). Not expressed in the spleen or bone marrow (PubMed:9881970). {ECO:0000269|PubMed:10602018, ECO:0000269|PubMed:18164222, ECO:0000269|PubMed:9881970}.
Induction：Isoform 1 expression oscillates diurnally in peripheral tissues such as liver, brown adipose tissue (BAT), kidney and small intestines. Isoform 2 is induced upon antigen receptor ligation in the presence of IL6 and TGB1 (via STAT3). Induced by TGFB1 in T-cells. {ECO:0000269|PubMed:18368049, ECO:0000269|PubMed:22753030}.
Developmental stage：In 3T3-L1 cells, sharp decline at mRNA and protein levels upon induction of adipocyte differentiation. Isoform 2 is detected in the immediate vicinity of vessels among small clusters of CD45(+) cells as early as 12.5 dpc. At 16.5 dpc, isoform 2 is expressed exclusively in tight clusters of cells found in lymph node anlagen, in the submucosal region of the intestine and around central vessels in the spleen. {ECO:0000269|PubMed:17666523, ECO:0000269|PubMed:21853531}.
Protein families：Nuclear hormone receptor family, NR1 subfamily