RHX13_MOUSE F6YCR7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:F6YCR7
Recommended name：Homeobox protein Rhox13
EC number：
Alternative names：(Reproductive homeobox protein 13)
Cleaved into：
GeneID：73614
Gene names (primary )：Rhox13
Gene names (synonym )：
Gene names (ORF )：
Length：232
Mass：25316
Sequence：MAHGVPFDHNYYIVECKEETNAEAQAGAMAATSTEEAPGAVEVAQAAVASSHDSGGAIGCATVKESESDSESESDSESESDSSDSSDESDDDSSTSDEDTSDPEEAAAPSVAAVAAAAAPPTVPAAAAIQIPGPYRYRPPRRHVRRRRRGPPFHFAQWQVEEMESLFEETQYPDLLTRGELARTLNVPEVKVKVWFTNRRAKQRKIERREMLRNIPPGAEDFIFITDFEEPS
Tissue specificity：
Induction：
Developmental stage：In adult testis, expressed in differentiating spermatagonia and preleptotene spermatocytes, but not during other stages of spermatogenesis (at protein level). Detected in testis from 13.5 days post coitum (dpc) onwards. Detected in ovary from 13.5 dpc, but levels gradually decline and are undetectable by 3 days post partum (dpp). {ECO:0000269|PubMed:18675325}.
Protein families：Paired-like homeobox family