PALM_MOUSE Q9Z0P4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Z0P4
Recommended name:Paralemmin-1
EC number:
Alternative names:(Paralemmin)
Cleaved into:
GeneID:18483
Gene names (primary ):Palm
Gene names (synonym ):
Gene names (ORF ):
Length:383
Mass:41614
Sequence:MEVLATDTASQQERLQAIAEKRRKQAEIESKRRQLEDDRRQLQYLKSKALRERWLLEGTPSSASEGDEDMRKQMQEDEQKARGLEESITRLEKEIDVLEFGESAPAASKENSAAPSPGRPQSASPAKEEQKSETLVNAQQTPLGTPKENRTSTPVRSPGGSTMMKAAMYSVEITVEKDKVTGETRVLSSTTVLPRDPLPQGVKVYEDETKVVHAVDGIAENGIQPLSSSEVDELIHKADEVTLSEAGSTAGPAEPRGLAEDVTRTTPSRREITGVEAQPGEATSGPPGIQPGQEPPVTMVFMGYQNVEDEAETKKVLGLQDTIKAELVVIEDAATPREPAPLNGSAAELPATKEENQTGPTTTPSDTQDLDMKKPRCRCCSVM
Tissue specificity:Expression is highest in brain, intermediate in adrenal gland and kidney, and much lower or undetectable in other tissues. Isoform 1 is the predominant isoform in most tissues except brain and kidney where isoform 2 predominates. {ECO:0000269|PubMed:9813098}.
Induction:
Developmental stage:In brain, expression is highest in neonates and declines to approximately 50% in adults. Isoform 2 is the predominant isoform in neonates with isoform 1 being barely detectable at this stage. Levels of isoform 1 increase with age, with the most pronounced increase between postnatal days 10 and 20. {ECO:0000269|PubMed:9813098}.
Protein families:Paralemmin family