BASI_MOUSE   P18572


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P18572

Recommended name:Basigin

EC number:

Alternative names:(Basic immunoglobulin superfamily) (HT7 antigen) (Membrane glycoprotein gp42) (CD antigen CD147)

Cleaved into:

GeneID:12215

Gene names  (primary ):Bsg

Gene names  (synonym ):

Gene names  (ORF ):

Length:389

Mass:42445

Sequence:MAAALLLALAFTLLSGQGACAAAGFLKAPLSQERWAGGSVVLHCEAVGSPIPEIQWWFEGNAPNDSCSQLWDGARLDRVHIHAAYRQHAASSLSVDGLTAEDTGTYECRASSDPDRNHLTRPPRVKWVRAQASVVVLEPGTIQTSVQEVNSKTQLTCSLNSSGVDIVGHRWMRGGKVLQEDTLPDLHTKYIVDADDRSGEYSCIFLPEPVGRSEINVEGPPRIKVGKKSEHSSEGELAKLVCKSDASYPPITDWFWFKTSDTGEEEAITNSTEANGKYVVVSTPEKSQLTISNLDVNVDPGTYVCNATNAQGTTRETISLRVRSRMAALWPFLGIVAEVLVLVTIIFIYEKRRKPDQTLDEDDPGAAPLKGSGTHMNDKDKNVRQRNAT

Tissue specificity:[Isoform 1]: Retina-specific (PubMed:12939332, PubMed:11273674, PubMed:11853760, PubMed:25957687). Expressed in both rods and cones (at protein level) (PubMed:25957687). {ECO:0000269|PubMed:11273674, ECO:0000269|PubMed:11853760, ECO:0000269|PubMed:12939332, ECO:0000269|PubMed:25957687}.; [Isoform 2]: Testis and caput, corpus and cauda epididymides (at protein level) (PubMed:11882021, PubMed:23727514, PubMed:21792931). Expressed in the brain, lung, liver, kidney, heart, spleen, uterus, retina and skeletal muscle (PubMed:2361961, PubMed:12939332, PubMed:12601063). {ECO:0000269|PubMed:11882021, ECO:0000269|PubMed:12601063, ECO:0000269|PubMed:12939332, ECO:0000269|PubMed:21792931, ECO:0000269|PubMed:2361961, ECO:0000269|PubMed:23727514}.

Induction:By estrogen in the uterine epithelium of ovariectomized animals. By eCG in ovary. {ECO:0000269|PubMed:12211060, ECO:0000269|PubMed:15095333}.

Developmental stage:In developing eye expressed at embryonic days 12 dpc, 15 dpc and 18 dpc, and at postnatal days P1, P7, P14, and P21. Expression progressed from a more generalized distribution throughout the undifferentiated neural retina to specific staining of retina-pigmented epithilia, the MCs, photoreceptor cells and the ciliary apparatus. Expression is highest at P21. Isoform 1 and isoform 2 are expressed at equivalent levels at P7, isoform 1 is more abundant at P14, P21 and P28. In uterus during the peri-implantation period strongly expressed in luminal and glandular epithelium on day 1 of pregnancy and gradually decreased to a basal level from day 2-4 of pregnancy. Expression in the sub-luminal stroma was first detected on day 3 of pregnancy and increased on day 4 of pregnancy. On day 5 of pregnancy, the expression of basigin protein and mRNA was only detected in the implanting embryos, and the luminal epithelium and sub-luminal stroma surrounding the embryos. In ovary during sexual maturation expressed in the granulosa cells of preantral follicles at days 20 and 25 after birth. Expressed during corpus luteum formation. {ECO:0000269|PubMed:12211060, ECO:0000269|PubMed:15037112, ECO:0000269|PubMed:15095333}.

Protein families:


   💬 WhatsApp