PNOC_MOUSE Q64387
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q64387
Recommended name：Prepronociceptin
EC number：
Alternative names：(N23K/N27K)
Cleaved into：Nocistatin; Nociceptin (Orphanin FQ) (PPNOC); Orphanin FQ2
GeneID：18155
Gene names (primary )：Pnoc
Gene names (synonym )：Npnc1
Gene names (ORF )：
Length：187
Mass：20884
Sequence：MKILFCDVLLLSLLSSVFSSCPRDCLTCQEKLHPAPDSFNLKTCILQCEEKVFPRPLWTVCTKVMASGSGQLSPADPELVSAALYQPKASEMQHLKRMPRVRSLVQVRDAEPGADAEPGADAEPGADDAEEVEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQYLVLSMQSSQRRRTLHQNGNV
Tissue specificity：Brain and spinal cord. Low levels in kidney and spleen.
Induction：
Developmental stage：In embryonic brain, first detected at day 14 and in postnatal brain, levels increase in day 1 and day 18. Levels decrease significantly in adults.
Protein families：Opioid neuropeptide precursor family