IFM5_MOUSE O88728
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O88728
Recommended name：Interferon-induced transmembrane protein 5
EC number：
Alternative names：(Bone-restricted interferon-induced transmembrane protein-like protein) (Bril) (Dispanin subfamily A member 1) (DSPA1) (Fragilis family member 4)
Cleaved into：
GeneID：73835
Gene names (primary )：Ifitm5
Gene names (synonym )：Bril Fragilis4
Gene names (ORF )：
Length：134
Mass：14667
Sequence：MDTSYPREDPRAPSSRKADAAAHTALSMGTPGPTPRDHMLWSVFSTMYLNLCCLGFLALVHSVKARDQKMAGNLEAARQYGSKAKCYNILAAMWTLVPPLLLLGLVVTGALHLSKLAKDSAAFFSTKFDEEDYN
Tissue specificity：Detected in embryonic bone (at protein level) (PubMed:18442316). Highly expressed in osteoblasts of adults and embryos. Expressed in primitive hemopoietic cells. {ECO:0000269|PubMed:11106657, ECO:0000269|PubMed:18442316}.
Induction：By interferons. {ECO:0000269|PubMed:12659663}.
Developmental stage：In embryos at 16.5 dpf, detected in lumbar and thoracic vertebra, the basisphenoid bone, the mandible, the coronal suture between the frontal and parietal bones, the maxilla, the nasal bone and the palate, as well as in the bone collars of long bones and digital bones in hind limbs, and in the primary ossification center. {ECO:0000269|PubMed:20838829}.
Protein families：CD225/Dispanin family