FA20A_MOUSE Q8CID3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8CID3
Recommended name：Pseudokinase FAM20A
EC number：
Alternative names：
Cleaved into：
GeneID：208659
Gene names (primary )：Fam20a
Gene names (synonym )：
Gene names (ORF )：
Length：541
Mass：61526
Sequence：MPGLRRDRLLALLLLGALFSADLYFHLWPQVQRQLRPGERPAACPCSGRAPSASLHSAAASRDLGTASHNFSGALPRVEHPSRGHPAPRSKLQALFAHSLYQVLEDPPLLGPEDWLLASQEALRYYRRKVARWNRRHKIYKEQFNLTSLDPPLQFRPEASWVQFHLGINSHGLYSRSSLAISKLLHDMRHFPTISADYSQDEKALLGACDCSQIVKPSGVHLKLVLRFSDFGKAMFKPMRQQREEETPEDFFYFIDFQRHNAEIAAFHLDRILDFRRVPPTVGRLVNVTKEILEVTKNEILQSVFFVSPANNVCFFAKCPYMCKTEYAVCGNPHLLEGSLSAFLPSLNLAPRLSVPNPWIRSYSLSGKEEWELNPLYCDTVKQIYPYNSSNRLLGIIDMAVFDFLIGNMDRHHYEMFTKFGDDGYLIHLDNARGFGRHSQDEISILAPLAQCCMIKRKTLLHLQLLAQADYRLSDVMRESLLEDQLSPVLTEPHLLALDRRLQIILKTVEDCIEAHGERRVIAEGSAQRSAPDSGQANLTS
Tissue specificity：Observed throughout the tissues of the mandibular incisor, including the secretory and maturation stage ameloblasts, the suprabasal layers of the gingival epithelium and the odontoblasts. Weak expression in the enamel matrix. {ECO:0000269|PubMed:21549343, ECO:0000269|PubMed:22732358}.
Induction：By all-trans retinoic acid (atRA) and IL3 in EML cell line. {ECO:0000269|PubMed:15676076}.
Developmental stage：In EML and MPRO cell lines, low levels in undifferentiated cells. Induced during maturation to promyelocyte stage of neutrophil differentiation. Decreased during neutrophil terminal differentiation. {ECO:0000269|PubMed:15676076}.
Protein families：FAM20 family