TEKT5_MOUSE G5E8A8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:G5E8A8
Recommended name：Tektin-5
EC number：
Alternative names：
Cleaved into：
GeneID：70426
Gene names (primary )：Tekt5
Gene names (synonym )：
Gene names (ORF )：
Length：557
Mass：62734
Sequence：MEFLGTTQTASFCGPKKGCGLQALPPAGQEPVVQECYQPFHLPGYRYLNAWRPSVFHKIATSQTIPEECSGIRRPPTILPSLRSALFCRYTPRDWDRSNDLQIRNAEASRLWASRLTGDSLRIMQDKDQLIHQMQEGTSRNLGQRLSDLGFWKSELCYELDRLLTENSSMDTLKRRLECAAEEVNCPLQVALECLYNREKRIGIDLVHDNVEKNLIREVDLLKCCQDQMRKLAKRIDFQIRDNRDAQHSLERDIEDKSSAQYIDENCFNLRSTSDSISFFHGVEKFDGTVSIPETWAKFSNDNIRHAQNMRANSIRLREEAEHLFETLSDQMWKQFTNTNLAFNARISEETDVKNKLQTQLAKILQEIFQAENTIMLLERAIVAKEYPLKMAQTMLACRTRRPNVELCRDVPQFRLVNEVFTIDDTLQTLKLRLRETQDTLQLLVMTKSRLEHELAIKANTLCIDKDKCMSMRKSFPSTPRLTGYTCSAIGSGPYANHAPRISSGPCSGSALCKGPASCGGGASCGGGASCGGHAPCGSALCSHSVSRSGPGFAPVC
Tissue specificity：Strongly expressed in germ cells of the testis (at protein level). Also detected in brain. {ECO:0000269|PubMed:20378928}.
Induction：
Developmental stage：In germ cells, has highest expression levels during late spermiogenesis (in round spermatids and condensing spermatids). {ECO:0000269|PubMed:20378928}.
Protein families：Tektin family