RETNG_MOUSE Q8K426
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8K426
Recommended name：Resistin-like gamma
EC number：
Alternative names：(Resistin-like molecule gamma) (RELMgamma) (Ten-cysteine protein 1) (XCP1)
Cleaved into：
GeneID：245195
Gene names (primary )：Retnlg
Gene names (synonym )：Xcp1
Gene names (ORF )：
Length：117
Mass：12535
Sequence：MLTFNKMKTTTCSLLICISLLQLMVPVNTEGTLESIVEKKVKELLANRDDCPSTVTKTFSCTSITASGRLASCPSGMTVTGCACGYGCGSWDIRDGNTCHCQCSTMDWATARCCQLA
Tissue specificity：Expressed in colon, lung, spleen, pancreas, ileum and bone marrow (at protein level) (PubMed:15834545). In colon, found throughout the crypt and surface epithelium, including goblet cells (at protein level) (PubMed:15834545). Highest expression is observed in bone marrow, spleen and lung, with lower levels in other tissues (PubMed:12782128, PubMed:14733912, PubMed:15064728, PubMed:15834545). Detected at low levels in granulocytes, but not found in monocytes or lymphocytes (PubMed:14733912). Has very weak expression in white adipose tissue (PubMed:12782128). {ECO:0000269|PubMed:12782128, ECO:0000269|PubMed:14733912, ECO:0000269|PubMed:15064728, ECO:0000269|PubMed:15834545}.
Induction：Up-regulated in colon and bone marrow in response to a high-fat diet. Also up-regulated in obese mice mutant for the leptin receptor LEPR (db/db genotype). {ECO:0000269|PubMed:15834545}.
Developmental stage：In liver, strongly expressed at 18 dpc and at birth, and then rapidly declines. In pancreas, strongly expressed at birth with decreasing expression after 4 days of age. Also shows strong expression in neonatal gut, lung and heart. {ECO:0000269|PubMed:15064728}.
Protein families：Resistin/FIZZ family