TNNT1_MOUSE   O88346


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O88346

Recommended name:Troponin T, slow skeletal muscle

EC number:

Alternative names:(TnTs) (Slow skeletal muscle troponin T) (sTnT)

Cleaved into:

GeneID:21955

Gene names  (primary ):Tnnt1

Gene names  (synonym ):

Gene names  (ORF ):

Length:262

Mass:31344

Sequence:MSDTEEQEYEEEQAEDEEAVEEEEAPEEPEPVAEREEERPKPSRPVVPPLIPPKIPEGERVDFDDIHRKRMEKDLLELQTLIDVHFEQRKKEEEELIALKDRIERRRAERAEQQRFRTEKERERQAKLAEEKMRKEEEEAKKRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGREMKLRILSERKKPLNIDYMGEDQLREKAQELSEWIHQLESEKFDLMEKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK

Tissue specificity:Expressed in adult soleus muscle. {ECO:0000269|PubMed:9651500}.

Induction:

Developmental stage:In masseter expression decreases during development and becomes undetectable 3 weeks after birth. {ECO:0000269|PubMed:9651500}.

Protein families:Troponin T family


   💬 WhatsApp