CST10_MOUSE Q9JM84
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JM84
Recommended name：Cystatin 10
EC number：
Alternative names：(Carminerin)
Cleaved into：
GeneID：58214
Gene names (primary )：Cst10
Gene names (synonym )：DD72
Gene names (ORF )：
Length：148
Mass：16451
Sequence：MASLLSPSMPVLAAVALTLTLAVIPEASTNAEAKQVVLGGVEPADPKDKEVQKVVKFAVRTYNDMDNDLYLSKPIRLMSASQQVVAGKNYYLKIELGRTTCTKTESNLVDCPFNEQPDQQKRVICNFQINVAPWLNKMSMTNFNCYNF
Tissue specificity：In cartilage, expressed mainly in mature chondrocytes including prehypertrophic and hypertrophic cells (at protein level) (PubMed:13679380). Expressed exclusively in cartilage (PubMed:11856874). {ECO:0000269|PubMed:11856874, ECO:0000269|PubMed:13679380}.
Induction：By high phosphate diet. {ECO:0000269|PubMed:11856874, ECO:0000269|PubMed:13679380}.
Developmental stage：In maturing chondrocytes, expression appears at day 3 and increases thereafter. {ECO:0000269|PubMed:13679380}.
Protein families：Cystatin family