EFNA1_MOUSE P52793
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P52793
Recommended name：Ephrin-A1
EC number：
Alternative names：(EPH-related receptor tyrosine kinase ligand 1) (LERK-1) (Immediate early response protein B61)
Cleaved into：Ephrin-A1, secreted form
GeneID：13636
Gene names (primary )：Efna1
Gene names (synonym )：Epgl1 Epl1 Lerk1
Gene names (ORF )：
Length：205
Mass：23802
Sequence：MEFLWAPLLGLCCSLAAADRHIVFWNSSNPKFREEDYTVHVQLNDYLDIICPHYEDDSVADAAMERYTLYMVEHQEYVACQPQSKDQVRWNCNRPSAKHGPEKLSEKFQRFTPFILGKEFKEGHSYYYISKPIYHQESQCLKLKVTVNGKITHNPQAHVNPQEKRLQADDPEVQVLHSIGYSAAPRLFPLVWAVLLLPLLLLQSQ
Tissue specificity：Expressed in myogenic progenitor cells. {ECO:0000269|PubMed:27446912}.
Induction：
Developmental stage：In myogenic progenitor cells, expressed during the acquisition of muscle stem cell properties, from 18.5 dpc to adulthood. {ECO:0000269|PubMed:27446912}.
Protein families：Ephrin family