EFNA4_MOUSE O08542
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O08542
Recommended name：Ephrin-A4
EC number：
Alternative names：(EPH-related receptor tyrosine kinase ligand 4) (LERK-4)
Cleaved into：
GeneID：13639
Gene names (primary )：Efna4
Gene names (synonym )：Epl4 Eplg4 Lerk4
Gene names (ORF )：
Length：206
Mass：22861
Sequence：MRLLPLLRTVLWAALLGSRLPGCSSLRHPIYWNSSNPRLLRGDAVVELGFNDYLDIFCPHYESPGPPEGPETFALYMVDWSGYEACTAEGANAFQRWNCSMPFAPFSPVRFSEKIQRYTPFPLGFEFLPGETYYYISVPTPESPGRCLRLQVSVCCKESGSSHESAHPVGSPGESGTSGWRGGHAPSPLCLLLLLLLPILRLLRVL
Tissue specificity：Expressed in myogenic progenitor cells. {ECO:0000269|PubMed:27446912}.
Induction：
Developmental stage：In myogenic progenitor cells, highly expressed at 11.5 dpc and ceases its expression at the late fetal stage (17.5 dpc). {ECO:0000269|PubMed:27446912}.
Protein families：Ephrin family