PEPA5_MOUSE   Q9D106


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9D106

Recommended name:Pepsin A-5

EC number:EC 3.4.23.1

Alternative names:(Pepsin F)

Cleaved into:

GeneID:58803

Gene names  (primary ):Pga5

Gene names  (synonym ):Pepf

Gene names  (ORF ):

Length:387

Mass:42824

Sequence:MKWLWVLGLVALSECLVKIPLMKIKSMRENLRESQVLKDYLEKYPRSRAHVLLEQRRNPAVTYEPMRNYLDLVYIGIISIGTPPQEFRVVLDTGSSVLWVPSIYCSSPACAHHKAFNPLRSSTFLVSGRPVNVAYGSGEMSGFLAYDTVRIGDLTVVAQAFGLSLEEPGIFMEYAVFDGILGLGYPNLGLQGITPVFDNLWLQGLIPQNLFAFYLSSKDEKGSMLMLGGVDPSYYHGELHWVPVSKPSYWQLAVDSISMNGEVIACDGGCQGIMDTGTSLLTGPRSSIVNIQNLIGAKASGDGEYFLKCDTINTLPDIVFTIGSVTYPVPASAYIRKDRSHNCRSNFEEGMDDPSDPEMWVLGDVFLRLYFTVFDRANNRIGLAPAA

Tissue specificity:Expressed in glandular chief cells of the neonatal stomach. Expressed in yolk sacs of the placenta (at protein level). {ECO:0000269|PubMed:11566730}.

Induction:

Developmental stage:In neonatal stomach, highly expressed for the first two weeks after birth, with rapidly decreasing expression after 17.5 days. In placenta, detected from 11.5 dpc until term. {ECO:0000269|PubMed:11566730}.

Protein families:Peptidase A1 family


   💬 WhatsApp