PROK1_MOUSE   Q14A28


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q14A28

Recommended name:Prokineticin-1

EC number:

Alternative names:(Endocrine-gland-derived vascular endothelial growth factor) (EG-VEGF)

Cleaved into:

GeneID:246691

Gene names  (primary ):Prok1

Gene names  (synonym ):Pk1

Gene names  (ORF ):

Length:105

Mass:11678

Sequence:MRGAVHIFIMLLLATASDCAVITGACERDIQCGAGTCCAISLWLRGLRLCTPLGREGEECHPGSHKIPFLRKRQHHTCPCSPSLLCSRFPDGRYRCFRDLKNANF

Tissue specificity:Highly expressed in liver and ovary and weakly expressed in testis and placenta. Expressed in mucosa and mesenchyme of embryonic gut during enteric nervous system development (at protein level). Predominantly expressed in kidney and liver. Also expressed in lung, ovary, placenta and testis. In fetal liver, is restricted to and highly expressed in hepatocytes. In adult kidney, expression is restricted to the endothelial tubule cells. In placenta, expressed throughout gestation. {ECO:0000269|PubMed:12746324, ECO:0000269|PubMed:17324478, ECO:0000269|PubMed:17531315}.

Induction:

Developmental stage:In placenta, at 7.5 dpc highly expressed in ectoplacental cone, endoderm and in giant cells, and at 9.5 dpc restricted mainly to the labyrinth layer (at protein level). In placenta, most highly expressed during early gestation (between 9.5 and 10.5 dpc). {ECO:0000269|PubMed:17531315}.

Protein families:AVIT (prokineticin) family


   💬 WhatsApp