RN212_MOUSE F6TQD1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:F6TQD1
Recommended name：Probable E3 SUMO-protein ligase RNF212
EC number：EC 2.3.2.-
Alternative names：(Probable E3 SUMO-protein transferase RNF212) (RING finger protein 212)
Cleaved into：
GeneID：
Gene names (primary )：Rnf212
Gene names (synonym )：
Gene names (ORF )：
Length：307
Mass：33898
Sequence：MASWVFCNRCFQSPHRKSSFSLTSCGHVYCHSCLLKGTKNECVICQAPCQTVLLSKHTNSNIQTFFLGIDGLCKKYSQETSQISEFQEKHRRRLVAFYQEKISQLEESLRKSVLQIKQLQSMRSSQQPAFNKIKNSVSTKPNGYLFLPPNSSLPDRIESMDIDLTPPARKPEMSAGPSRISVISPPQDGRMGSVTCRGPQHLSLTPSHASMTKASRVPPLQMPYKELSPPPASQLSSRATQGPSPSVSSSWTGPPRQPISISGLLQRQCAGSASPRGMDTEKMSPFLPSTPTNLRSVASPWHACVHR
Tissue specificity：Specifically expressed in meiocytes of the gonads. {ECO:0000269|PubMed:23396135}.
Induction：
Developmental stage：In spermatocytes, first detected at the transition from leptonema to zygonema, localizing specifically to initial sites of homolog synapsis. The number of synaptonemal complex-associated Rnf212 increases as synapsis proceeds. Excluded from unsynapsed homolog. In early pachynema, as cells complete synapsis, detected as a punctate pattern of irregular foci along the synaptonemal complexes. Also localizes to the synapsed pseudoautosomal regions of the X-Y chromosomes. After early pachynema, protein levels strongly drop. By midpachynema, Rnf212 foci only remain at sites where crossovers form. Remaining foci disappear in late pachynema before the disassembly of synaptonemal complexes at diplonema and are not detected in early diplotene-stage cells in which homologs begin to desynapse. Pattern in fetal oocytes is very similar, except that the late-stage Rnf212 foci are still detected in nuclei in both the late-pachytene and early diplotene stages (at protein level). {ECO:0000269|PubMed:23396135, ECO:0000269|PubMed:24390283}.
Protein families：