DMC1_MOUSE Q61880
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q61880
Recommended name：Meiotic recombination protein DMC1/LIM15 homolog
EC number：
Alternative names：
Cleaved into：
GeneID：13404
Gene names (primary )：Dmc1
Gene names (synonym )：Dmc1h Lim15
Gene names (ORF )：
Length：340
Mass：37821
Sequence：MKEDQVVQEESGFQDDEESLFQDIDLLQKHGINMADIKKLKSVGICTIKGIQMTTRRALCNVKGLSEAKVEKIKEAANKLIEPGFLTAFQYSERRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQLPGTGGYSGGKIIFIDTENTFRPDRLRDIADRFNVDHEAVLDNVLYARAYTSEHQMELLDYVAAKFHEEAGIFKLLIIDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAKE
Tissue specificity：Testis. {ECO:0000269|PubMed:30760716, ECO:0000269|PubMed:8581742}.
Induction：
Developmental stage：In spermatocytes, shows punctate localization along chromosome axes specifically in early meiotic prophase I cells. Foci start to appear from the leptotene stage, reach their greatest number in the zygotene stage, in the early pachytene stage, the DMC1 foci mostly disappeared from autosomes and became restricted to the sex chromosomes. {ECO:0000269|PubMed:30760716}.
Protein families：RecA family, DMC1 subfamily