PRS42_MOUSE Q8VIF2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8VIF2
Recommended name：Serine protease 42
EC number：EC 3.4.21.-
Alternative names：(Testis serine protease 2)
Cleaved into：
GeneID：235628
Gene names (primary )：Prss42
Gene names (synonym )：Tessp2
Gene names (ORF )：
Length：335
Mass：36683
Sequence：MASGGGSLGLIVFLLLLQPKPCEAWAAASVLSTSGFPSGFSEAPRDNPPPPTRVRMSKATTRSPFMNFSLVCGQPFMKIMGGVDAEEGKWPWQVSVRVRHMHVCGGSLINSQWVLTAAHCIYSRIQYNVKVGDRSVYRQNTSLVIPIKTIFVHPKFSTTIVVKNDIALLKLQHPVNFTTNIYPVCIPSESFPVKAGTKCWVTGWGKLVPGAPDVPTEILQEVDQNVILYEECNEMLKKATSSSVDLVKRGMVCGYKERGKDACQGDSGGPMSCEFENKWVQVGVVSWGISCGRKGYPGVYTDVAFYSKWLIAVVNQADCLHPVVFLVLLLCSLTS
Tissue specificity：Testis-specific (PubMed:23536369). Mainly detected in round spermatids at all the eminiferous epithelial stages (at protein level) (PubMed:23536369). {ECO:0000269|PubMed:23536369}.
Induction：
Developmental stage：In testis, expressed at all stages from the late pachytene primary spermatocyte to the secondary spermatocyte. Not detected at day 7 after birth. Expression is detected at day 14 and increases dramatically at day 21 and reach a peak at day 28 to remain high until day 56. {ECO:0000269|PubMed:23536369}.
Protein families：Peptidase S1 family