UBA1Y_MOUSE P31254
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P31254
Recommended name:Ubiquitin-like modifier-activating enzyme 1 Y
EC number:EC 6.2.1.45
Alternative names:(Ubiquitin-activating enzyme E1) (Ubiquitin-activating enzyme E1 Y)
Cleaved into:
GeneID:
Gene names (primary ):Uba1y
Gene names (synonym ):Sby Ube1ay Ube1y Ube1y1
Gene names (ORF ):
Length:1058
Mass:118038
Sequence:MSSSVLSKKRKVSGPDSSLDSSWSPTYSVMFGVPPGPTNEMSKNKEMDIDESLYSRQLYVLGHEAMKHLQASSVLISGLQGLGVEIAKNIILGGVKAVTLHDQGIAQWADLSSQFCLREEDIGKNRAEISQPRLAELNSYVPVFAYTGPLIEEFLSGFQVVVLTNTPLEYQLQVGEFCHSHGIKLVVADTRGLVGQLFCDFGEEMILTDSNGEQPLSAMVSMITKENPGIVTCLEDSRHGFESGDFISFTEVQGMSELNGIGPIEIKVLGPYTFSICDTSSFSEYIRGGIVSQVKVPRKINFKPLLASLAEPEFVVTDFAKCCHPAQLHIGFQALHQFCTQHSRPPRPHNEEDAEELVTLAQSVNAQALPAVQQDCLDIDLIRKLAYVAAGDLAPMNAFFGGLAAQEVMKACSGKFMPIRQWLYFDALECLPEHRVAFMEDKCLPHQNRYDGQVAVFGSDLQEKLGKQKYFLVGAGAIGCELLKNFAMIGLGCGEDGEITVTDMDTIEKSNLNRQFLFRPWDITKLKSETAAAAVRDINPHIRIFSHQNRVGPETEHVYDDDFFQKLDGVANALDNVDARLYVDRRCVYYRKPLLESGTLGTKGNVQVVVPFLTESYSSSQDPPEKSIPICTLKNFPNAIEHTVQWARDEFEGLFKQSAENVNQYLTDPKFMERTLQLAGTQPLEVLEAIHCSLVLQRPQTWADCVTWAYQHWHTQYSHNIQQLLHNFPPAQLTSSGALFWSGPKRCPHPLTFDINNPLHLDYVMAAANLFAQTYGLGGSQDCAVVAKLLQSLPVPKFAPKSGIRIHVSEQELQSTSATTIDDSHLEELKTALPTPDKLLGFKMYPIDFEKDDDSNFHMDFIVAASNLRAENYGISPADRHKSKLIAGKIIPAIATTTSAIVGLVCLELYKVVQGHQQLESYKNSFINLALPLFSFSAPLAPECHQYYDQEWTLWDRFDVQGLQPSGEEMTLKQFLDYFKTEHKLEVIMLSQGVSMLYSVFMPASKLKERLDQPMTEIVSCVSKQKLGHHVKSLVFELCCNSDSGDDIEVPYVRYIIR
Tissue specificity:Expressed in testis in A spermatogonia and spermatids but not (or at very low levels) in pachytene spermatocytes. Also expressed in Y-bearing ovaries and at very low levels in adrenal gland. {ECO:0000269|PubMed:8948595}.
Induction:
Developmental stage:In testis, expression detected at 12.5 days post coitum (dpc) and peaking at 14.5 dpc, with expression dropping to low levels at the day of birth. After birth, levels increase 4-fold to a peak at 10 days post partum (dpp) and fall again thereafter. {ECO:0000269|PubMed:8948595}.
Protein families:Ubiquitin-activating E1 family