CSTL1_MOUSE Q80Y72
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q80Y72
Recommended name：Cystatin-like 1
EC number：
Alternative names：
Cleaved into：
GeneID：228756
Gene names (primary )：Cstl1
Gene names (synonym )：Rcet1
Gene names (ORF )：
Length：140
Mass：16199
Sequence：MEMKARGLRIPLLLLLVTVVVMAKVNHIQRWGGFKEKAMSKKNINSTLHFFIRSYNNASNDTYLYQVQKLIQGQMQLTTGVEYLVTVKIGRTKCKKNETKKASCPLQSSKLKKSLICKSLIYSVPWMNYYQLWNNSCQES
Tissue specificity：Highly expressed in testis where it localizes to spermatogonium, spermatocyes and round spermatids. Not detected in spermatozoa. Also detected in epididymis, cerebrum and pituitary. {ECO:0000269|PubMed:18300157}.
Induction：
Developmental stage：In testis, expression levels increase from postnatal week 4 onwards with peak levels at postnatal week 8. Expression remains high thereafter. {ECO:0000269|PubMed:18300157}.
Protein families：Cystatin family