DNM3L_MOUSE   Q9CWR8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CWR8

Recommended name:DNA (cytosine-5)-methyltransferase 3-like

EC number:

Alternative names:

Cleaved into:

GeneID:54427

Gene names  (primary ):Dnmt3l

Gene names  (synonym ):

Gene names  (ORF ):

Length:421

Mass:47993

Sequence:MGSRETPSSCSKTLETLDLETSDSSSPDADSPLEEQWLKSSPALKEDSVDVVLEDCKEPLSPSSPPTGREMIRYEVKVNRRSIEDICLCCGTLQVYTRHPLFEGGLCAPCKDKFLESLFLYDDDGHQSYCTICCSGGTLFICESPDCTRCYCFECVDILVGPGTSERINAMACWVCFLCLPFSRSGLLQRRKRWRHQLKAFHDQEGAGPMEIYKTVSAWKRQPVRVLSLFRNIDKVLKSLGFLESGSGSGGGTLKYVEDVTNVVRRDVEKWGPFDLVYGSTQPLGSSCDRCPGWYMFQFHRILQYALPRQESQRPFFWIFMDNLLLTEDDQETTTRFLQTEAVTLQDVRGRDYQNAMRVWSNIPGLKSKHAPLTPKEEEYLQAQVRSRSKLDAPKVDLLVKNCLLPLREYFKYFSQNSLPL

Tissue specificity:Expressed in testis, thymus, ovary, and heart (PubMed:11306809). {ECO:0000269|PubMed:11306809}.

Induction:

Developmental stage:In testis, first observed in non-dividing prospermatogonia after 12.5 dpc and is highest at about the time of birth; expression declines rapidly after birth and is extinguished by 6 days post partum, when most prospermatogonia have differentiated into dividing spermatogonial stem cells (PubMed:15318244). {ECO:0000269|PubMed:15318244}.

Protein families:


   💬 WhatsApp