CPLX3_MOUSE Q8R1B5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8R1B5
Recommended name：Complexin-3
EC number：
Alternative names：(Complexin III) (CPX III)
Cleaved into：
GeneID：235415
Gene names (primary )：Cplx3
Gene names (synonym )：
Gene names (ORF )：
Length：158
Mass：17586
Sequence：MAFMVKSMVGGQLKNLTGSLGGGEDKGDGDKSAAEAQGMSREEYEEYQKQLVEEKMERDAQFTQRKAERATLRSHFRDKYRLPKNETDESQIQLAGGDVELPRELAKMIEEDTEEEEDKASVLGQLASLPGLDLSSLKDKAQTTLGDLKQSAEKCHIM
Tissue specificity：Present in many brain regions, including hippocampus and cerebellum (at protein level) (PubMed:15911881). Expressed in the retina (at protein level) (PubMed:15911881, PubMed:19386896). Expressed in retinal amacrine cells (at protein level) (PubMed:19386896, PubMed:22694764). Expressed in retinal photoreceptor ribbon synapses (PubMed:19386896). Expressed in the retinal inner nuclear layer, at bipolar cells (at protein level) (PubMed:22694764). Expressed in cone photoreceptor synaptic terminals (at protein level) (PubMed:22694764). {ECO:0000269|PubMed:15911881, ECO:0000269|PubMed:19386896, ECO:0000269|PubMed:22694764}.
Induction：
Developmental stage：In the brain, expression starts at P6 and increases to reach a plateau at P20. {ECO:0000269|PubMed:15911881}.
Protein families：Complexin/synaphin family