CPLX2_MOUSE P84086
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P84086
Recommended name：Complexin-2
EC number：
Alternative names：(921-L) (Complexin II) (CPX II) (Synaphin-1)
Cleaved into：
GeneID：12890
Gene names (primary )：Cplx2
Gene names (synonym )：
Gene names (ORF )：
Length：134
Mass：15394
Sequence：MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAEREKVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKK
Tissue specificity：Nervous system. Expressed predominantly in brain, where it is present in many regions, including hippocampus and cerebellum. In the retina, present at conventional amacrine cell synapses (at protein level). {ECO:0000269|PubMed:15911881, ECO:0000269|PubMed:7635198}.
Induction：
Developmental stage：In the brain, expression starts at P6 and increases to reach a plateau at P20. {ECO:0000269|PubMed:15911881}.
Protein families：Complexin/synaphin family