CBLN4_MOUSE Q8BME9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BME9
Recommended name：Cerebellin-4
EC number：
Alternative names：(Cerebellin-like glycoprotein 1)
Cleaved into：
GeneID：228942
Gene names (primary )：Cbln4
Gene names (synonym )：Cblnl1
Gene names (ORF )：
Length：198
Mass：21609
Sequence：MGSARRALSVVPAVLLILVLPVWAQNDTEPIVLEGKCLVVCDSNPATDSKGSSSSPLGISVRAANSKVAFSAVRSTNHEPSEMSNKTRIIYFDQILVNVGNFFTLESVFVAPRKGIYSFSFHVIKVYQSQTIQVNLMLNGKPVISAFAGDKDVTREAATNGVLLYLDKEDKVYLKLEKGNLLGGWQYSTFSGFLVFPL
Tissue specificity：Expressed in brain with high levels in particular thalamic nuclei. In the thalamus, predominantly expressed in neurons within the parafascicular nucleus. Found in the hippocampus, mostly in the dendrites and somata of pyramidal neurons (at protein level). Very low or no expression in most other brain regions. Highly expressed in the ventral medial habenula. {ECO:0000269|PubMed:16930405, ECO:0000269|PubMed:22220752, ECO:0000269|PubMed:25534236, ECO:0000269|PubMed:30287486}.
Induction：
Developmental stage：In the developing brain, expressed as early as 10-13 dpc. Expression level peaks at 18 dpc and gradually decreases afterwards. Expressed in developing somatostatin-positive basket cells. {ECO:0000269|PubMed:16930405, ECO:0000269|PubMed:30679375}.
Protein families：