SOCS2_MOUSE O35717
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35717
Recommended name：Suppressor of cytokine signaling 2
EC number：
Alternative names：(SOCS-2) (Cytokine-inducible SH2 protein 2) (CIS-2)
Cleaved into：
GeneID：216233
Gene names (primary )：Socs2
Gene names (synonym )：Cis2 Cish2
Gene names (ORF )：
Length：198
Mass：22434
Sequence：MTLRCLEPSGNGADRTRSQWGTAGLPEEQSPEAARLAKALRELSQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPTLQHFCRLAINKCTGTIWGLPLPTRLKDYLEEYKFQV
Tissue specificity：Expressed primarily in the testis, some expression in liver and lung.
Induction：
Developmental stage：In the developing brain, expressed at relatively high levels from 10 dpc stages to young adulthood (P25) with peak levels from 14 dpc to P8. Levels of SOCS2 increase dramatically between 10 dpc and 12 dpc. At 12 dpc, high expression found in the olfactory epithelium with moderate expression in the neuroepithelium of the neocortex, presumptive striatum, hippocampus and septum. Low expression in the retina. At 14 dpc, in the cortical wall, levels increase in the cortical plate and decrease in the intermediate zone. High expression also in the hippocampus, fimbria, thalamic neuroepithelium and innermost layer of the retina. At P8, high expression in the neurons of the hippocampus. Lower levels found in the dentate gyrus. Levels of expression decrease between P8 and P15 and remain constant until P25. In adulthood, levels decrease. In the peripheral nervous system, expression found at low levels at 14 dpc in a subpopulation of neurons in the dorsal root ganglion. {ECO:0000269|PubMed:10867663}.
Protein families：