CBLN3_MOUSE Q9JHG0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JHG0
Recommended name:Cerebellin-3
EC number:
Alternative names:
Cleaved into:
GeneID:56410
Gene names (primary ):Cbln3
Gene names (synonym ):
Gene names (ORF ):
Length:197
Mass:21077
Sequence:MGTEWHKPKLSLALVLLTLEAGWAQEGSEPVLLEGECLVVCEPGRPTAGGPGGAALGEAPPGRVAFAAVRSHHHEPAGETGNGTSGAIYFDQVLVNEGEGFDRTSGCFVAPVRGVYSFRFHVVKVYNRQTVQVSLMLNTWPVISAFANDPDVTREAATSSVLLPLDPGDRVSLRLRRGNLLGGWKYSSFSGFLIFPL
Tissue specificity:Expressed in brain, restricted to the cerebellar cortex. Within the cerebellum, expressed in granule layers (at protein level). Also detected in postsynaptic Purkinje cell spines (at protein level). {ECO:0000269|PubMed:16930405, ECO:0000269|PubMed:17331201}.
Induction:
Developmental stage:In the developing brain, selectively expressed as early as postnatal day 7-10 in cerebellar granule cells. {ECO:0000269|PubMed:16930405}.
Protein families: