KHDR2_MOUSE Q9WU01
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9WU01
Recommended name:KH domain-containing, RNA-binding, signal transduction-associated protein 2
EC number:
Alternative names:(Sam68-like mammalian protein 1) (SLM-1) (mSLM-1)
Cleaved into:
GeneID:170771
Gene names (primary ):Khdrbs2
Gene names (synonym ):Slm1
Gene names (ORF ):
Length:349
Mass:38866
Sequence:MGEEKYLPELMAEKDSLDPSFVHASRLLAEEIEKFQGSDGKKEDEEKKYLDVISNKNIKLSERVLIPVKQYPKFNFVGKLLGPRGNSLKRLQEETGAKMSILGKGSMRDKTKEEELRKSGEAKYAHLSDELHVLIEVFAPPGEAYSRMSHALEEIKKFLVPDYNDEIRQEQLRELSYLNGSEESGRGRGIRGRGIRITPTAPSRGRGGAVPPPPPPGRGVLTPRGTTVTRGALPVPPIARGVPTPRARGTAAVPGYRAPPPPAHDAYEEYGYDDGYGGEYDDQTYEAYDNSYVTPTQSVPEYYDYGHGVNEDAYDSYAPEEWATTRSSLKAPPPRSARGGYREHPYGRY
Tissue specificity:Expressed in heart, skin, brain, colon, spleen, kidney, cervix and testis. In adult cerebellum expressed predominantly in Purkinje cells and in the hippocampus is abundantly expressed in glutamatergic dentate granule cells and in specific inhibitory Schaffer collateral-associated and path-associated interneurons; expression is restricted to neuronal subpopulations largely non-overlapping with expression of KHDRBS3/SLM-2 (at protein level). {ECO:0000269|PubMed:15471878, ECO:0000269|PubMed:22196734}.
Induction:
Developmental stage:In the developing cerebellum expression is increasing in the first 3 postnatal weeks. {ECO:0000269|PubMed:22196734}.
Protein families:KHDRBS family