MFRN1_MOUSE Q920G8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q920G8
Recommended name：Mitoferrin-1
EC number：
Alternative names：(Mitochondrial iron transporter 1) (Mitochondrial solute carrier protein) (Solute carrier family 25 member 37)
Cleaved into：
GeneID：67712
Gene names (primary )：Slc25a37
Gene names (synonym )：Mfrn Mscp
Gene names (ORF )：
Length：338
Mass：37510
Sequence：MELRRGGVGNQAAGRRMDGDCRDGGCGSKDAGSEDYENLPTSASVSTHMTAGAMAGILEHSIMYPVDSVKTRMQSLNPDPKARYTSIYGALKRIMHTEGFWRPLRGLNVMMMGAGPAHAMYFACYENMKRTLNDVFSHQGNSHLANGVAGSMATLLHDAVMNPAEVVKQRLQMYNSQHQSAFSCIRTVWRTEGLGAFYRSYTTQLTMNIPFQSIHFITYEFLQEQVNPRRDYNPQSHIISGGLAGALAAAATTPLDVCKTLLNTQENMALSLANVSGRLSGMANAFRTVYQLNGLAGYFKGIQARVIYQMPSTAISWSVYEFFKYILTKRQLENRTLY
Tissue specificity：Highly expressed in hematopoietic organs, fetal liver, bone marrow and spleen. {ECO:0000269|PubMed:11845285, ECO:0000269|PubMed:16511496}.
Induction：
Developmental stage：In the developing embryo, it is first detected at 7.5 dpc in the extraembryonic yolk sac, coincident with the appearance of blood islands. Later, restricted expression is seen in 14.5 dpc fetal liver, the primary source of erythrocyte production in mid-gestation. Expression decreases in the spleen around 4-5 weeks of age, suggesting that it is decreased during splenic lymphocyte maturation. {ECO:0000269|PubMed:16511496}.
Protein families：Mitochondrial carrier (TC 2.A.29) family