SFRP1_MOUSE Q8C4U3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8C4U3
Recommended name：Secreted frizzled-related protein 1
EC number：
Alternative names：(sFRP-1)
Cleaved into：
GeneID：20377
Gene names (primary )：Sfrp1
Gene names (synonym )：
Gene names (ORF )：
Length：314
Mass：35413
Sequence：MGVGRSARGRGGAASGVLLALAAALLAAGSASEYDYVSFQSDIGSYQSGRFYTKPPQCVDIPVDLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHMGTQVFLCSLFAPVCLDRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNTTEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKELKRLVLFLKNGADCPCHQLDNLSHNFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKRMKNHECPTFQSVFK
Tissue specificity：Highly expressed in kidney and embryonic heart. Also highly expressed in the eye, where it is principally localized to the ciliary body and the lens epithelium. Weaker expression in heart, lung and brain. In the brain, is expressed exclusively in the choroid plexus. {ECO:0000269|PubMed:9096311}.
Induction：
Developmental stage：In the developing kidney expressed at 13.5 dpc in the periphery of the metanophros and surrounding the uretic and nephrogenic tubules. At 14.5 dpc, expression decreases in the outer cortical cells and becomes visible in the tubular parts of the nephron. From 15.5 dpc, highly expressed in the future loops of Henle. In the developing CNS, expression located to the forebrain and hindbrain. At 8.0 dpc, expressed in the future forebrain and in the ventral portion of the presumptive hindbrain. At 8.5 dpc, expression is maintained in these tissues with a strong signal in rhombomere 4. Until 11.5 dpc, expression continues in the hindbrain with additional expression at 9.5 dpc and 10.5 dpc, in the nasal and epibranchial placodes. In the forbrain, initial expression is found in the proencephalon of the forebrain, and then strong expression in the telencephalic vesicle up to 15.5 dpc. Expression is then found in specific cell populations throughout the brain. In the developing eye, expression, by 10.5 dpc, is confined to ectodermal cells overlying the dorsal part of the optic cup. In later stages, expression limited to the lens fiber cells and the future pigmented retina. By 15.5 dpc, expression is confined to the anterior part of the lens. During limb development, barely expressed until later stages, when it is found in the distal part of the separating phalanges. In other developing structures, expressed in nasal placodes at 9.5 dpc, in medial nasal processes at 10.5 dpc and then in the anterior portion of the invaginating olfactory epithelium. At 15.5 dpc, expressed on the basal side of the nasal epithelium. Also expressed in developing teeth, with the highest levels at 15.5 dpc and 16.5 dpc in the mesenchyme and the dental epithelium of the developing molars. As well, expressed in the ventral body wall, in the mesenchyme derived adrenal cortex, the cochlear epithelium and the branching epithelium of the salivary gland. In the developing heart, weakly expressed from 8.5 dpc in the tubular heart endocardium and myocardium. From 8.5 dpc to 12.5 dpc expressed in cardiomyocytes. At 9.5 dpc, expression found in the common ventricular and atrial chamber of the developing heart, in the aortic sac and in the sinus venosus. High expression found from 11.5 dpc-12.5 dpc, in the trabeculated wall of the ventricular chamber together with the wall of the atrial chamber. Expression also found in the muscular part of the interventricular septum. From 9.5 dpc-11.5 dpc expression in the visceral yolk sac confined to the inner lining endothelial cell layer. Expression in the developing heart decreases after 14.5 dpc. {ECO:0000269|PubMed:10640709, ECO:0000269|PubMed:9739103}.
Protein families：Secreted frizzled-related protein (sFRP) family