KRA14_MOUSE O08640
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O08640
Recommended name：Keratin-associated protein 14
EC number：
Alternative names：(Anagen-specific protein KAP13) (mKAP13) (Pubertal mammary gland-specific protein 1)
Cleaved into：
GeneID：23927
Gene names (primary )：Krtap14
Gene names (synonym )：Pmg1
Gene names (ORF )：
Length：167
Mass：17919
Sequence：MSCNSCSGTFSQSFGGQLQYPISSCGSSYPNNVFYSTDLQTPITHQLGSSLHSGCQETFCEPTNCQTAYVVSRPCQRPFYSQRIRGPCRPCQSTFSGSLGFGSRGFQSFGCGYPSQGFGSHGFQSVGCGTPTFSSLNCGSSFYRPTCFSTKSCQSVSYQPTCGTGFF
Tissue specificity：Expressed at high levels in skin where it is found predominantly in the keratogenous zone of hair follicle cortical cells and at lower levels in the epithelium of the developing mammary gland. {ECO:0000269|PubMed:10446281, ECO:0000269|PubMed:9287118, ECO:0000269|PubMed:9804342}.
Induction：
Developmental stage：In the developing mammary gland, expression is barely detected in the immature gland at 3 weeks after birth but is evident at the onset of puberty at 3.5 weeks. Expression is high at 4 weeks, declines at 4.5 weeks and is undetectable at 5 weeks. No expression is detected in the mature mammary gland during estrus, pregnancy, lactation or involution. In skin, expression starts shortly after birth and reaches a first maximum at 9 days. A second peak of expression is observed at 3.5 weeks, then levels decline and remain low in the adult. During the hair growth cycle, detected in mid- and late-anagen stages but not in catagen, telogen or early anagen phases. {ECO:0000269|PubMed:10446281, ECO:0000269|PubMed:9287118, ECO:0000269|PubMed:9804342}.
Protein families：PMG family