ZDH21_MOUSE Q9D270
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D270
Recommended name：Palmitoyltransferase ZDHHC21
EC number：EC 2.3.1.225
Alternative names：(DHHC domain-containing cysteine-rich protein 21) (DHHC21) (GABA-A receptor-associated membrane protein 3) (Zinc finger DHHC domain-containing protein 21)
Cleaved into：
GeneID：68268
Gene names (primary )：Zdhhc21
Gene names (synonym )：Gramp3
Gene names (ORF )：
Length：265
Mass：31331
Sequence：MGLRIHFVVDPHGWCCMGLIVFVWLYNIVIIPKIVLFPHYEEGHIPGILIIIFYGISIFCLVALVRASLTDPGRLPENPKIPHAERELWELCNKCNLMRPKRSHHCSRCGHCVRRMDHHCPWINNCVGEDNHWLFLQLCFYTELLTCYALMFSFCHYYYFLPLKKRNLDLFVVRHELAIMRLAAFMGITMLVGITGLFYTQLIGIITDTTSIEKMSNCCEEISRPRKPWQQTFSEVFGTRWKILWFIPFRQRQPLRVPYHFANHV
Tissue specificity：Widely expressed (PubMed:26715683). Expressed in Henle's layer within the hair bulb and the hair shaft cuticle (at protein level) (PubMed:19956733). Expression is limited to the post-mitotic lineages of inner root sheath (IRS) and cuticle (PubMed:19956733). {ECO:0000269|PubMed:19956733, ECO:0000269|PubMed:26715683}.
Induction：
Developmental stage：In the developing skin, expression is not be detected prior to hair follicle induction (13 dpc). Expression is initially detected in the inner root sheath (IRS) of developing vibrissae follicles at 16 dpc and later in the developing IRS of E18.5 pelage follicles. {ECO:0000269|PubMed:19956733}.
Protein families：DHHC palmitoyltransferase family