ZN365_MOUSE Q8BG89
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BG89
Recommended name：Protein ZNF365
EC number：
Alternative names：(DISC1-binding zinc-finger protein) (Su48)
Cleaved into：
GeneID：216049
Gene names (primary )：Znf365
Gene names (synonym )：Dbz Kiaa0844 Zfp365
Gene names (ORF )：
Length：408
Mass：46860
Sequence：MQQTTFEESRYHWQDSLENVAVCLPFRCPRCGDHTRFRSLSSLRAHLEFSHSYEERTLLTKCSLLPSLKDTELLRSSELPKQGKVLRGHAKVTKQKSSYVNLYSISHGHSKDTKPFEMVAERPVSYVQTYTAVDIRADSLDAPCASPGLPTQDTKAAFEAHVREKFNRMVEAVDRTIEKRIDKLTKELAQKTAELLEVRAAFAQLTQKKQEVQRRERALNKQVDVAVEMIAVLKQRLTESEEELLRKEEEVVTFNHFLEAAAEKEVQGKARLQDFIENLLQRVELAEKQLEYYQSQQASGFSCDTSEHMLTDIPSNRKPRCLSRGHQHSVCNHPEMRAHFHLKGRSYLKKAKDERAGMQPAKAIHEPAESPREFFRPAKKGEHLGLSRKGNFRPKMAKKKPTAIVNII
Tissue specificity：Detected in several tissues, with highest levels in brain. Also expressed during embryonic development. Expressed in cerebral cortex, hippocampus, striatum, inferior colliculus and thalamus (PubMed:23912123). {ECO:0000269|PubMed:15363853, ECO:0000269|PubMed:16617106, ECO:0000269|PubMed:23912123}.
Induction：Induced by gamma irradiation. {ECO:0000269|PubMed:23966166}.
Developmental stage：In the embryo at day 14.5 post-coitum, expressed in the basal, medial and lateral ganglionic eminences of the cerebral cortex, but not in the caudal ganglionic eminence (PubMed:23912123). Expressed in the corpus callosum from postnatal day 7 (PD7) to PD56 with a peak at PD14 (PubMed:24481677). {ECO:0000269|PubMed:23912123, ECO:0000269|PubMed:24481677}.
Protein families：