SGCA_MOUSE   P82350


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P82350

Recommended name:Alpha-sarcoglycan

EC number:

Alternative names:(Alpha-SG) (50 kDa dystrophin-associated glycoprotein) (50DAG) (Adhalin)

Cleaved into:

GeneID:20391

Gene names  (primary ):Sgca

Gene names  (synonym ):

Gene names  (ORF ):

Length:387

Mass:43287

Sequence:MAAAVTWIPLLAGLLAGLRDTKAQQTTLHLLVGRVFVHPLEHATFLRLPEHVAVPPTVRLTYHAHLQGHPDLPRWLHYTQRSPYNPGFLYGSPTPEDRGYQVIEVTAYNRDSFDTTRQRLLLLIGDPEGPRLPYQAEFLVRSHDVEEVLPTTPANRFLTALGGLWEPGELQLLNITSALDRGGRVPLPIEGRKEGVYIKVGSATPFSTCLKMVASPDSYARCAQGQPPLLSCYDTLAPHFRVDWCNVSLVDKSVPEPLDEVPTPGDGILEHDPFFCPPTEATDRDFLTDALVTLLVPLLVALLLTLLLAYIMCFRREGRLKRDMATSDIQMFHHCSIHGNTEELRQMAASREVPRPLSTLPMFNVRTGERLPPRVDSAQMPLILDQH

Tissue specificity:Striated muscle, both skeletal and cardiac. {ECO:0000269|PubMed:9196068}.

Induction:

Developmental stage:In the embryo, expression begins at day 14 and coincides with the onset of primary myogenesis. {ECO:0000269|PubMed:9196068}.

Protein families:Sarcoglycan alpha/epsilon family