PAX9_MOUSE P47242
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P47242
Recommended name：Paired box protein Pax-9
EC number：
Alternative names：
Cleaved into：
GeneID：18511
Gene names (primary )：Pax9
Gene names (synonym )：Pax-9
Gene names (ORF )：
Length：342
Mass：36389
Sequence：MEPAFGEVNQLGGVFVNGRPLPNAIRLRIVELAQLGIRPCDISRQLRVSHGCVSKILARYNETGSILPGAIGGSKPRVTTPTVVKHIRTYKQRDPGIFAWEIRDRLLADGVCDKYNVPSVSSISRILRNKIGNLAQQGHYDSYKQHQPAPQPALPYNHIYSYPSPITAAAAKVPTPPGVPAIPGSVALPRTWPSSHSVTDILGIRSITDQGVSDSSPYHSPKVEEWSSLGRNNFPAAAPHAVNGLEKGALEQEAKYGQAPNGLPAVSSFVSASSMAPYPTPAQVSPYMTYSAAPSGYVAGHGWQHAGSTPLSPHNCDIPASLAFKGMQAAREGSHSVTASAL
Tissue specificity：In the embryo, expressed in pharyngeal pouches and derivatives, developing vertebral column, tail, head and limbs.
Induction：
Developmental stage：In the embryo, expression increases slightly from day 9.5 to day 11.5, remains almost constant until day 14.5 and then decreases.
Protein families：