ZNF22_MOUSE Q9ERU3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9ERU3
Recommended name：Zinc finger protein 22
EC number：
Alternative names：(Zinc finger protein 422) (Zinc finger protein Krox-25) (Zinc finger protein Krox-26)
Cleaved into：
GeneID：67255
Gene names (primary )：Znf22
Gene names (synonym )：Krox25 Krox26 Zfp422
Gene names (ORF )：
Length：237
Mass：27294
Sequence：MRLGKPKGGISRSASQGKAYESKRKTARQRQKWGVAIRFDSGLSRRRRNVDEKPYKCAKCSKSFSQSSTLFQHKKIHTGKKSHKCADCGKSFFQSSNLIQHRRIHTGEKPYKCDECGERFKQSSNLIQHQRIHTGEKPYCCDECGRCFSQSSHLIQHQRTHTGEKPYQCEECDKCFSQSSHLRQHMKVHKEKKPHKRGKNARVKTHPVSWKRGKGRKAVAGIRQVKGATSGLFKKKK
Tissue specificity：Expressed predominantly in developing craniofacial bones and dental organs, and in molar tooth germs of postnatal animals. Also detected in embryonic heart, liver, thymus, kidney, brain, lung, muscle and calvaria. In the adult, highly expressed in lung, kidney, bone and incisors. {ECO:0000269|PubMed:12489153, ECO:0000269|PubMed:12952191, ECO:0000269|PubMed:14706453}.
Induction：
Developmental stage：In the embryo, expression is detected from day 7 with highest levels between days 11 and 15. {ECO:0000269|PubMed:12489153, ECO:0000269|PubMed:12952191}.
Protein families：Krueppel C2H2-type zinc-finger protein family