DAZL_MOUSE Q64368
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q64368
Recommended name：Deleted in azoospermia-like
EC number：
Alternative names：(DAZ-like autosomal) (Deleted in azoospermia-like 1)
Cleaved into：
GeneID：13164
Gene names (primary )：Dazl
Gene names (synonym )：Dazl1 Dazla
Gene names (ORF )：
Length：298
Mass：33313
Sequence：MSATTSEAPNSAVSREASTQSSSATTSQGYVLPEGKIMPNTVFVGGIDVRMDETEIRSFFARYGSVKEVKIITDRTGVSKGYGFVSFYNDVDVQKIVESQINFHGKKLKLGPAIRKQNLCTYHVQPRPLIFNPPPPPQFQSVWSSPNAETYMQPPTMMNPITQYVQAYPPYPSSPVQVITGYQLPVYNYQMPPQWPAGEQRSYVIPPAYTTVNYHCSEVDPGADILPNECSVHDAAPASGNGPQKKSVDRSIQTVVSCLFNPENRLRNSLVTQDDYFKDKRVHHFRRSRAVLKSDHLC
Tissue specificity：Expressed predominantly in testis with lower levels in ovary. In testis, it is expressed in pachytene spermatocytes and at lower level in type-B spermatogonia, preleptotene and zygotene spermatocytes. In ovary, it is expressed in maturing follicles. In embryonic and prepuberal ovary, it is expressed in the oocyte and follicular cells. {ECO:0000269|PubMed:9288969}.
Induction：
Developmental stage：In the testis, expression increases steadily after birth until the first spermatogonial cells appear, levels off as the first spermatogenic cells enter meiosis (10 days after birth) and remains at this level thereafter.
Protein families：RRM DAZ family