OFUT1_MOUSE   Q91ZW2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q91ZW2

Recommended name:GDP-fucose protein O-fucosyltransferase 1

EC number:EC 2.4.1.221

Alternative names:(Peptide-O-fucosyltransferase 1) (O-FucT-1)

Cleaved into:

GeneID:140484

Gene names  (primary ):Pofut1

Gene names  (synonym ):

Gene names  (ORF ):

Length:393

Mass:44688

Sequence:MGAAAWAPPHLLLRASFLLLLLLLPLRGRSAGSWDLAGYLLYCPCMGRFGNQADHFLGSLAFAKLLNRTLAVPPWIEYQHHKPPFTNLHVSYQKYFKLEPLQAYHRVVSLEDFMENLAPSHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGPFWDQFHVSFNKSELFTGISFSASYKEQWTQRFPAKEHPVLALPGAPAQFPVLEEHRELQKYMVWSDEMVRTGEALISAHLVRPYVGIHLRIGSDWKNACAMLKDGTAGSHFMASPQCVGYSRSTATPLTMTMCLPDLKEIQRAVTLWVRALNARSVYIATDSESYVSEIQQLFKDKVRVVSLKPEVAQIDLYILGQADHFIGNCVSSFTAFVKRERDLHGRQSSFFGMDRPSQLRDEF

Tissue specificity:

Induction:

Developmental stage:Increased expression throughout embryo development. Ubiquitous expression at 9.5 dpc and 11.5 dpc with lower expression at 9.5 dpc. {ECO:0000269|PubMed:12697902}.

Protein families:Glycosyltransferase 65 family


   💬 WhatsApp