PR8A8_MOUSE   Q9DAS4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9DAS4

Recommended name:Prolactin-8A8

EC number:

Alternative names:(Placental prolactin-like protein C3) (PLP-C3) (PRL-like protein C3) (Prolactin-like protein C-gamma) (PLP C-gamma)

Cleaved into:

GeneID:74188

Gene names  (primary ):Prl8a8

Gene names  (synonym ):Prlpc3

Gene names  (ORF ):

Length:241

Mass:28089

Sequence:MELQFRQPHFSDALLLLLLSNLLLWEKASSIPACMAEKSGCWNPRMETFDSAIRKAETLRTVSKQFYVELYHNQFSSGKFATLTSKLVRRDEIVFRAASHCHSTLTNPPNKGIQYITIEIPEYLKTLINYVGAWISPLFHLVIELSAMKDVPETILSKAKEIEENNRQILRDLRWIITEVYPTSKKKEIFPSWELLSFLKSSSRNSKFLAMFNLSHCLEYDTQFFLFHLRILKCRITGKDC

Tissue specificity:Expressed specifically in the placenta. Predominantly expressed in spongiotrophoblast cells.

Induction:

Developmental stage:Increases in abundance as gestation advanced. Predominandtly expressed in the junctional zone during the latter third of gestation.

Protein families:Somatotropin/prolactin family


   💬 WhatsApp