MIXL1_MOUSE Q9WUI0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9WUI0
Recommended name：Homeobox protein MIXL1
EC number：
Alternative names：(Homeodomain protein MIX) (mMix) (MIX1 homeobox-like protein 1) (Mix.1 homeobox-like protein)
Cleaved into：
GeneID：27217
Gene names (primary )：Mixl1
Gene names (synonym )：Mix Mml
Gene names (ORF )：
Length：231
Mass：24844
Sequence：MAAAGSQQLQFAEGAAFPIFPAAHPGGQLLPAMRPASGLPAAPHDSRAPAATQCFPNRDSSPTAQTPAGLDPPGPSKGSAAPSAPQRRKRTSFSSEQLQLLELVFRQTMYPDIHLRERLAALTLLPESRIQVWFQNRRAKSRRQSGKSFQPLSSRRGVFLHCPAPGTEARCLKPQLPLEADVNHVPDPSMTGGGVCTSGSQSFETYSSLSEDIGSKLDSWEEHIFSALGNF
Tissue specificity：Expressed in the primitive streak of the gastrulating embryo, and marks cells destined to form mesoderm and endoderm. Present in differentiating embryonic stem cells (at protein level). {ECO:0000269|PubMed:12619131, ECO:0000269|PubMed:16433620}.
Induction：By TGF-beta. Regulated by Nodal in mesendoderm morphogenesis. Regulated by FOXH1, which acts as a negative regulator by recruiting GSC to promoter during early development. {ECO:0000269|PubMed:15982639, ECO:0000269|PubMed:17568773}.
Developmental stage：Initially expressed in visceral endoderm and becomes restricted to primitive streak and nascent mesoderm at gastrulation. This includes the hemangioblast, a precursor of hematopoietic and vascular stem cells. At 5.5 dpc, it is expressed symmetrically in the visceral endoderm but by 6.0 dpc this expression is noticeably asymmetric. At 6.5 dpc, expression is restricted to the nascent primitive streak and persists in the primitive streak through 7.5-9.5 dpc, marking those cells fated to form extra-embryonic and lateral mesoderm. {ECO:0000269|PubMed:10495285, ECO:0000269|PubMed:12619131}.
Protein families：Paired homeobox family