HXC8_MOUSE P09025
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P09025
Recommended name：Homeobox protein Hox-C8
EC number：
Alternative names：(Homeobox protein Hox-3.1) (Homeobox protein M31)
Cleaved into：
GeneID：15426
Gene names (primary )：Hoxc8
Gene names (synonym )：Hox-3.1 Hoxc-8
Gene names (ORF )：
Length：242
Mass：27740
Sequence：MSSYFVNPLFSKYKGGESLEPAYYDCRFPQSVGRSHALVYGPGGSAPGFQHASHHVQDFFHHGTSGISNSGYQQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSANTNSSEGQGHLNQNSSPSLMFPWMRPHAPGRRSGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKLPGARDEEKVEEEGNEEEEKEEEEKEENKD
Tissue specificity：
Induction：
Developmental stage：Initially found in all tissues of the posterior region in 8.5 and 9.5 dpc. Embryos, it eventually become specifically located in neural tissue.
Protein families：Antp homeobox family