HXD1_MOUSE Q01822
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q01822
Recommended name:Homeobox protein Hox-D1
EC number:
Alternative names:(Homeobox protein Hox-4.9)
Cleaved into:
GeneID:15429
Gene names (primary ):Hoxd1
Gene names (synonym ):Hox-4.9 Hoxd-1
Gene names (ORF ):
Length:328
Mass:34180
Sequence:MSSYLEYVSCAAGGGSGGVGGDVLGFAPKFCRADARPVALQPAFPLGSGDGAFVSCLPLATARPTPSPPAGPAQSPVPQPAAPRYAPCTLEGAYERGAAPASAAEYGFLGSGPAFDFPGALGRAADEGGAHVHYATSAVFSGGGSFLLSGQVDFAAFGEPGPFPACLKEPADGHPGPFQTVSPAPGACPKPASPTSSLPAAHSTFEWMKVKRNAPKKSKLSEYGATSPPSAIRTNFSTKQLTELEKEFHFNKYLTRARRIEIANCLQLNDTQVKIWFQNRRMKQKKREREGLLATAASVASIKLPRSETSPIKSGRNLGSPSQAQEPS
Tissue specificity:
Induction:
Developmental stage:Is first detected at the end of the late streak stage in presumptive lateral and extraembryonic mesoderm. During early neurogenesis, it is detected solely in lateral mesoderm. By late neurogenesis and through mid-gestation, it is found in a restricted region of presumed trunk neural crest and the dermatome.
Protein families:Antp homeobox family, Labial subfamily