ABLM1_MOUSE Q8K4G5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8K4G5
Recommended name：Actin-binding LIM protein 1
EC number：
Alternative names：(abLIM-1) (Actin-binding LIM protein family member 1)
Cleaved into：
GeneID：226251
Gene names (primary )：Ablim1
Gene names (synonym )：Ablim Kiaa0059
Gene names (ORF )：
Length：861
Mass：96805
Sequence：MPSLLGLKCLGKLCSSEIGKVPSPERASLRNSHRRLLIEDLSVPETPDPAHRRRGTVIHLVYLYSAGCGPPELRFSSYDPSVAHPQDPHHSSEKPVIHCHKCGEPCKGEVLRVQTKHFHIKCFTCKVCGCDLAQGGFFIKNGDYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPNCFACTICKRPFPPGDRVTFNGRDCLCQLCAQPMSSSPKEASCSSNCAGCGRDIKNGQALLALDKQWHLGCFKCKSCGKVLTGEYISKDGSPYCEKDYQGLFGVKCEACHQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKQSTKTEEKLRPPNIPRSSSDFFYPKSLIRRTGRSPALQLLSPPCLTNSNKNPRQPTRTSSESIYSRPGSSIPGSPGHTIYAKVDNEILDYKDLAAIPKVKAIYDIERPDLITYEPFYTSGYEDKQERQSLGESPRTLSPTPSAEGYQDVRDRMIHRSTSQGSINSPVYSRHSYTPTTSRSPQHFHRPELLSPGVHRWSPLRTSSFSSTHSDSRPNPPFRHHFLPHVKGNEPSSGRNSPLPYRPDSRPLTPTYAQAPKHFHVPDQGINIYRKPPIYKQHAALAAQSKASEDIIKFSKFPAAQAPDPNEIPKIETDHWPGPPSLAAVGTDPRRRSSGREEDEEELLRRRQLQEEQLMKLNSGLGQLILKEEMEKESRERASLASRYDSPLHSASHAPSSKTSSLPGYGKNGLHRPVSTDFAQYNSYGDISGGVRDYQTLPDGHMPAVRMDRGVSMPNMLEPKIFPYEMLMVTNRGRNKILRDVDRTRLERHLAPEVFWEIFGMSIQEFDKLPLWRRNDMKKKAKLF
Tissue specificity：Isoform 1 is detected in adult retina, where it is highly expressed in the ganglion layer. Detected in rod inner segment. Isoform 2 is highly expressed in adult retina, brain, kidney and heart. Isoform 3 is highly expressed in adult retina, brain, kidney, liver, skeletal muscle, spleen and heart. Detected in embryonic retina, brain, spinal cord, peripheral sensory ganglia and thymus. {ECO:0000269|PubMed:11163266, ECO:0000269|PubMed:12849746, ECO:0000269|PubMed:9245787}.
Induction：
Developmental stage：Isoform 1 is detected at low levels starting from 12 dpc and remains constant until birth. After this levels increase strongly and expression remains high in adults. Isoform 2 and isoform 3 are expressed at a constant high level throughout development. {ECO:0000269|PubMed:12849746, ECO:0000269|PubMed:9245787}.
Protein families：