DND1_MOUSE Q6VY05
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6VY05
Recommended name:Dead end protein homolog 1
EC number:
Alternative names:(RNA-binding motif, single-stranded-interacting protein 4)
Cleaved into:
GeneID:213236
Gene names (primary ):Dnd1
Gene names (synonym ):Rbms4 Ter
Gene names (ORF ):
Length:352
Mass:39076
Sequence:MQSKRECEQWCERVNPENKAALEAWVRETGIRLVQVNGQRKYGGPPPGWVGSPPPSGSEVYIGRLPQDVYEHQLIPLFQRVGRLYEFRLMMTFSGLNRGFAYARYSSRRGAQAAIATLHNHQLRPSCQLLVCRSTEKCELTVDGLPLSLNRRALLLALQPFGPCLQETLLLPSPGSAPSQIALLKFSTHRAAAMAKKALVEGQSRLCGEQVAVEWLKPDLKQHFRQQLAGPSLRFLRPDVSQLTQTREKLGSQGARAALQLLCQRMKLGSPVFLTKCLGTGPAGWHRFWYQVVIPGHPVPFSGLIWVVLASDWQDGHEVAKDAVSAQLLEALSEPRTSLWSPGAEAGTMVKQ
Tissue specificity:Isoform 1 and isoform 2 are expressed in testis. Isoform 1 is expressed continuously in post natal (PN) testis although levels are low between PN1 to PN6. Isoform 2 is expressed from PN 20 onwards. Isoform 2 is strongly expressed in meiotic and in post-meiotic germ cells of the testis with highest expression at the elongated spermatid stage (at protein level). Expressed in testis and heart. Expressed in germ cells and genital ridges. Not detected in testicular tumors. {ECO:0000269|PubMed:15902260, ECO:0000269|PubMed:17291453}.
Induction:
Developmental stage:Isoform 1, but not isoform 2, is expressed in embryos at 13.5 and 15.5 dpc. Isoform 1, but not isoform 2, is expressed in primordial gonads at 13.5 and 15.5 dpc. Isoform 1, but not isoform 2, is expressed in ES cell lines. Isoform 1, but not isoform 2, is expressed in embryonic germ (EG) cells (at protein level). Detected in the embryo and allantoic bud at 7.5 dpc, in the neuroectoderm at 8.5 dpc, and widespread at 9.5 dpc, including the neural tube, head mesenchyme, first branchial arch and the hindgut, through which primordial germ cells are migrating. At 11.5 dpc, also expressed in the XY and XX genital ridges. Expressed in genital ridges at 13.5 dpc. Between 12.5 to 14.5 dpc, up-regulated in the testis cords of the XY gonads and down-regulated in XX gonads. Down-regulation occurs progressively as an anterior to posterior wave. {ECO:0000269|PubMed:15902260, ECO:0000269|PubMed:17291453, ECO:0000269|PubMed:18509452}.
Protein families: