ARP19_MOUSE P56212
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P56212
Recommended name：cAMP-regulated phosphoprotein 19
EC number：
Alternative names：(ARPP-19)
Cleaved into：
GeneID：59046
Gene names (primary )：Arpp19
Gene names (synonym )：
Gene names (ORF )：
Length：112
Mass：12293
Sequence：MSAEVPEAASAEEQKEMEDKVTSPEKAEEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYFDSGDYNMAKAKMKNKQLPAAAPDKTEVTGDHIPTPQDLPQRKPSLVASKLAG
Tissue specificity：
Induction：
Developmental stage：Isoform ARPP-19 is highly expressed in the embryo and its levels decrease progressively as development proceeds. In contrast, isoform ARPP-16 appears in the brain at the end of the first postnatal week and increases to reach a plateau. {ECO:0000269|Ref.1}.
Protein families：Endosulfine family