NDRG3_MOUSE Q9QYF9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9QYF9
Recommended name：Protein NDRG3
EC number：
Alternative names：(N-myc downstream-regulated gene 3 protein) (Protein Ndr3)
Cleaved into：
GeneID：29812
Gene names (primary )：Ndrg3
Gene names (synonym )：Ndr3
Gene names (ORF )：
Length：375
Mass：41555
Sequence：MDELQDVQLTEIKPLLNDKNGTRNFQDFDCQEHDIETPHGMVHVTIRGLPKGNRPVILTYHDIGLNHKSCFNTFFNFEDMQEITQHFAVCHVDAPGQQEAAPSFPTGYQYPTMDELAEMLPPVLTHLSMKSIIGIGVGAGAYILSRFALNHPELVEGLVLINIDPCAKGWIDWAASKLSGFTTNIVDIILAHHFGQEELQANLDLIQTYRLHIAQDINQENLQLFLGSYNGRRDLEIERPILGQNDNRLKTLKCSTLLVVGDNSPAVEAVVECNSRLDPINTTLLKMADCGGLPQVVQPGKLTEAFKYFLQGMGYIPSASMTRLARSRTHSTSSSIGSGESPFSRSVTSNQSDGTQESCESPDVLDRHQTMEVSC
Tissue specificity：Expressed at high levels in brain, followed by small intestine and kidney (at protein level). Also expressed in thymus. {ECO:0000269|PubMed:21636852}.
Induction：
Developmental stage：Its expression is already significant at 9.5 dpc, covering the entire embryo except the heart, and it shows only a slight increase in later developmental stages.
Protein families：NDRG family